CT45A5 (NM_001172288) Human Recombinant Protein

CT45A5 protein,

Purified recombinant protein of Homo sapiens cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2.

Product Info Summary

SKU: PROTP0DMU8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CT45A5 (NM_001172288) Human Recombinant Protein

View all CT45A5 recombinant proteins

SKU/Catalog Number

PROTP0DMU8

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CT45A5 (NM_001172288) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0DMU8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0217kDa

Amino Acid Sequence

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSNFSGDDLECRGIASSPKSQQEINADIKCQVVKEIRCLGRKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI

Validation Images & Assay Conditions

Gene/Protein Information For CT45A5 (Source: Uniprot.org, NCBI)

Gene Name

CT45A5

Full Name

Cancer/testis antigen family 45 member A5

Weight

0.0217kDa

Superfamily

CT45 family

Alternative Names

Cancer/testis antigen family 45 member A5 CT45A5 CT45-3, CT45-4, CT45-6, CT45.5, CT455, CT45A3, CT45A4, CT45A6, CT45A7 cancer/testis family 45 member A5 cancer/testis family 45 member A5|Cancer/testis 45-3|Cancer/testis 45-4|Cancer/testis 45-6|Cancer/testis 45A3|Cancer/testis 45A4|Cancer/testis 45A6|Cancer/testis 45A7|Cancer/testis family 45 member A3|Cancer/testis family 45 member A4|Cancer/testis family 45 member A6|Cancer/testis family 45 member A7|cancer/testis 45-5|cancer/testis 45A5|cancer/testis CT45-5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CT45A5, check out the CT45A5 Infographic

CT45A5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CT45A5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used CT45A5 (NM_001172288) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CT45A5 (NM_001172288) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CT45A5 (NM_001172288) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0DMU8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.