CT45A2 (NM_152582) Human Recombinant Protein

CT45A2 protein,

Recombinant protein of human cancer/testis antigen family 45, member A2 (CT45A2)

Product Info Summary

SKU: PROTQ5DJT8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CT45A2 (NM_152582) Human Recombinant Protein

View all CT45A2 recombinant proteins

SKU/Catalog Number

PROTQ5DJT8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cancer/testis antigen family 45, member A2 (CT45A2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CT45A2 (NM_152582) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5DJT8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.1 kDa

Amino Acid Sequence

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI

Validation Images & Assay Conditions

Gene/Protein Information For CT45A2 (Source: Uniprot.org, NCBI)

Gene Name

CT45A2

Full Name

Cancer/testis antigen family 45 member A2

Weight

21.1 kDa

Superfamily

CT45 family

Alternative Names

Cancer/testis antigen family 45 member A2 CT45A2 CT45-2, CT45.2, CT45A8, CT45A9 cancer/testis family 45 member A2 cancer/testis family 45 member A2|Cancer/testis 45A8|Cancer/testis 45A9|Cancer/testis family 45 member A8|Cancer/testis family 45 member A9|cancer/testis 45-2|cancer/testis 45A2|cancer/testis CT45

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CT45A2, check out the CT45A2 Infographic

CT45A2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CT45A2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5DJT8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CT45A2 (NM_152582) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CT45A2 (NM_152582) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CT45A2 (NM_152582) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5DJT8
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.