CSAG1 (NM_153478) Human Recombinant Protein

CSAG1 protein,

Product Info Summary

SKU: PROTQ6PB30
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CSAG1 (NM_153478) Human Recombinant Protein

View all CSAG1 recombinant proteins

SKU/Catalog Number

PROTQ6PB30

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens chondrosarcoma associated gene 1 (CSAG1), transcript variant a

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CSAG1 (NM_153478) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6PB30)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.5 kDa

Amino Acid Sequence

MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKEVPGTKGSP

Validation Images & Assay Conditions

Gene/Protein Information For CSAG1 (Source: Uniprot.org, NCBI)

Gene Name

CSAG1

Full Name

Putative chondrosarcoma-associated gene 1 protein

Weight

8.5 kDa

Alternative Names

Cancer/testis antigen 24.1; Cancer/testis antigen CSAGE; chondrosarcoma associated gene 1; CSAGEcancer/testis antigen family 24, member 1; CT24.1putative chondrosarcoma-associated gene 1 protein CSAG1 CSAGE, CT24.1 chondrosarcoma associated gene 1 putative chondrosarcoma-associated gene 1 protein|cancer/testis 24.1|cancer/testis CSAGE|cancer/testis family 24, member 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSAG1, check out the CSAG1 Infographic

CSAG1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSAG1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6PB30

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CSAG1 (NM_153478) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CSAG1 (NM_153478) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CSAG1 (NM_153478) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6PB30
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.