CORO2A (NM_003389) Human Recombinant Protein

CORO2A protein,

Recombinant protein of human coronin, actin binding protein, 2A (CORO2A), transcript variant 1

Product Info Summary

SKU: PROTQ92828
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CORO2A (NM_003389) Human Recombinant Protein

View all CORO2A recombinant proteins

SKU/Catalog Number

PROTQ92828

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human coronin, actin binding protein, 2A (CORO2A), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CORO2A (NM_003389) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92828)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

59.6 kDa

Amino Acid Sequence

MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDADTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL

Validation Images & Assay Conditions

Gene/Protein Information For CORO2A (Source: Uniprot.org, NCBI)

Gene Name

CORO2A

Full Name

Coronin-2A

Weight

59.6 kDa

Superfamily

WD repeat coronin family

Alternative Names

CLIPINB; coronin, actin binding protein, 2A; coronin, actin-binding protein, 2A; coronin-like protein B; DKFZp686G19226; IR10coronin 2A; WD protein IR10; WD repeat-containing protein 2; WDR2coronin-2A; WD-repeat protein 2 CORO2A CLIPINB, IR10, WDR2 coronin 2A coronin-2A|WD protein IR10|WD repeat-containing protein 2|WD-repeat protein 2|coronin, actin binding protein, 2A|coronin-like protein B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CORO2A, check out the CORO2A Infographic

CORO2A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CORO2A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92828

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CORO2A (NM_003389) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CORO2A (NM_003389) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CORO2A (NM_003389) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92828
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.