CNRIP1 (NM_015463) Human Recombinant Protein

CNRIP1 protein,

Product Info Summary

SKU: PROTQ96F85
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CNRIP1 (NM_015463) Human Recombinant Protein

View all CNRIP1 recombinant proteins

SKU/Catalog Number

PROTQ96F85

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CNRIP1 (NM_015463) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96F85)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.5 kDa

Amino Acid Sequence

MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL

Validation Images & Assay Conditions

Gene/Protein Information For CNRIP1 (Source: Uniprot.org, NCBI)

Gene Name

CNRIP1

Full Name

CB1 cannabinoid receptor-interacting protein 1

Weight

18.5 kDa

Superfamily

CNRIP family

Alternative Names

CB1 cannabinoid receptor-interacting protein 1 CNRIP1 C2orf32, CRIP-1, CRIP1 cannabinoid receptor interacting protein 1 CB1 cannabinoid receptor-interacting protein 1|cannabinoid receptor CB1-interacting protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CNRIP1, check out the CNRIP1 Infographic

CNRIP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CNRIP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96F85

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CNRIP1 (NM_015463) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CNRIP1 (NM_015463) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CNRIP1 (NM_015463) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96F85
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product