CLEC4E (NM_014358) Human Recombinant Protein

CLEC4E protein,

Product Info Summary

SKU: PROTQ9ULY5
Size: 20 µg
Source: HEK293T

Product Name

CLEC4E (NM_014358) Human Recombinant Protein

View all CLEC4E recombinant proteins

SKU/Catalog Number

PROTQ9ULY5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human C-type lectin domain family 4, member E (CLEC4E)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CLEC4E (NM_014358) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9ULY5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.9 kDa

Amino Acid Sequence

MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

Validation Images & Assay Conditions

Gene/Protein Information For CLEC4E (Source: Uniprot.org, NCBI)

Gene Name

CLEC4E

Full Name

C-type lectin domain family 4 member E

Weight

24.9 kDa

Alternative Names

CLEC4E; CLECSF9; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 9; C-type lectin domain family 4 member E; C-type lectin domain family 4, member E; Macrophage-inducible C-type lectin; MINCLE; MINCLEC-type lectin superfamily member 9 CLEC4E CLECSF9, MINCLE C-type lectin domain family 4 member E C-type lectin domain family 4 member E|C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9|C-type lectin superfamily member 9|macrophage-inducible C-type lectin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLEC4E, check out the CLEC4E Infographic

CLEC4E infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLEC4E: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9ULY5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CLEC4E (NM_014358) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CLEC4E (NM_014358) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CLEC4E (NM_014358) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9ULY5
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product