CDK2AP1 (NM_004642) Human Recombinant Protein

CDK2AP1 protein,

Product Info Summary

SKU: PROTO14519
Size: 20 µg
Source: HEK293T

Product Name

CDK2AP1 (NM_004642) Human Recombinant Protein

View all CDK2AP1 recombinant proteins

SKU/Catalog Number

PROTO14519

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDK2AP1 (NM_004642) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14519)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.2 kDa

Amino Acid Sequence

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS

Validation Images & Assay Conditions

Gene/Protein Information For CDK2AP1 (Source: Uniprot.org, NCBI)

Gene Name

CDK2AP1

Full Name

Cyclin-dependent kinase 2-associated protein 1

Weight

12.2 kDa

Superfamily

CDK2AP family

Alternative Names

CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1; CDKAP1; cyclin-dependent kinase 2 associated protein 1; Deleted in oral cancer 1; Deleted in oral cancer-1; doc-1; DOC1Putative oral cancer suppressor; DORC1; p12DOC-1; ST19 CDK2AP1 DOC1, DORC1, ST19, doc-1, p12DOC-1 cyclin dependent kinase 2 associated protein 1 cyclin-dependent kinase 2-associated protein 1|CDK2-associated protein 1|Deleted in oral cancer-1|deleted in oral cancer 1|putative oral cancer suppressor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDK2AP1, check out the CDK2AP1 Infographic

CDK2AP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDK2AP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14519

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDK2AP1 (NM_004642) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDK2AP1 (NM_004642) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDK2AP1 (NM_004642) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14519
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.