CD239 (BCAM) (NM_005581) Human Recombinant Protein

BCAM/CD239 protein,

Product Info Summary

SKU: PROTP50895
Size: 20 µg
Source: HEK293T

Product Name

CD239 (BCAM) (NM_005581) Human Recombinant Protein

View all BCAM/CD239 recombinant proteins

SKU/Catalog Number

PROTP50895

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human basal cell adhesion molecule (Lutheran blood group) (BCAM), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD239 (BCAM) (NM_005581) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP50895)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

64.2 kDa

Amino Acid Sequence

MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC

Validation Images & Assay Conditions

Gene/Protein Information For BCAM (Source: Uniprot.org, NCBI)

Gene Name

BCAM

Full Name

Basal cell adhesion molecule

Weight

64.2 kDa

Alternative Names

antigen identified by monoclonal F8; Auberger B antigen; basal cell adhesion molecule (Lu and Au blood groups); basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule; B-CAM cell surface glycoprotein; BCAM; B-cell adhesion molecule; CD239 antigen; CD239; F8/G253 antigen; glycoprotein 95kDa; LUAU; Lutheran antigen; Lutheran blood group (Auberger b antigen included); Lutheran blood group glycoprotein; MSK19 BCAM AU, CD239, LU, MSK19 basal cell adhesion molecule (Lutheran blood group) basal cell adhesion molecule|Auberger b |B-CAM cell surface glycoprotein|B-cell adhesion molecule|F8/G253 |Lutheran blood group variant LUGA|basal cell adhesion molecule (Lu and Au blood groups)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BCAM, check out the BCAM Infographic

BCAM infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BCAM: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP50895

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD239 (BCAM) (NM_005581) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD239 (BCAM) (NM_005581) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD239 (BCAM) (NM_005581) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP50895
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.