CCN5 (NM_003881) Human Recombinant Protein

CCN5 protein,

Product Info Summary

SKU: PROTO76076
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CCN5 (NM_003881) Human Recombinant Protein

View all CCN5 recombinant proteins

SKU/Catalog Number

PROTO76076

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human WNT1 inducible signaling pathway protein 2 (WISP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CCN5 (NM_003881) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO76076)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.2 kDa

Amino Acid Sequence

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Validation Images & Assay Conditions

Gene/Protein Information For CCN5 (Source: Uniprot.org, NCBI)

Gene Name

CCN5

Full Name

CCN family member 5

Weight

24.2 kDa

Superfamily

CCN family

Alternative Names

CCN family member 5 CCN5 CT58, CTGF-L, WISP2 cellular communication network factor 5 CCN family member 5|WNT1 inducible signaling pathway protein 2|connective tissue growth factor-like protein|connective tissue growth factor-related protein 58

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCN5, check out the CCN5 Infographic

CCN5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCN5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO76076

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CCN5 (NM_003881) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CCN5 (NM_003881) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CCN5 (NM_003881) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO76076
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.