CCDC169 (NM_001144981) Human Recombinant Protein

Ccdc169 protein,

Recombinant protein of human chromosome 13 open reading frame 38 (C13orf38), transcript variant 1

Product Info Summary

SKU: PROTA6NNP5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CCDC169 (NM_001144981) Human Recombinant Protein

View all Ccdc169 recombinant proteins

SKU/Catalog Number

PROTA6NNP5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 13 open reading frame 38 (C13orf38), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CCDC169 (NM_001144981) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6NNP5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.1 kDa

Amino Acid Sequence

MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTGRYNPAKQKTVSAKRGPVKKITRPNHLPELHP

Validation Images & Assay Conditions

Gene/Protein Information For CCDC169 (Source: Uniprot.org, NCBI)

Gene Name

CCDC169

Full Name

Coiled-coil domain-containing protein 169

Weight

25.1 kDa

Superfamily

CCDC169 family

Alternative Names

Coiled-coil domain-containing protein 169

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCDC169, check out the CCDC169 Infographic

CCDC169 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCDC169: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA6NNP5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CCDC169 (NM_001144981) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CCDC169 (NM_001144981) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CCDC169 (NM_001144981) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6NNP5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.