CA5A (NM_001739) Human Recombinant Protein

Carbonic Anhydrase VA/CA5A protein,

Recombinant protein of human carbonic anhydrase VA, mitochondrial (CA5A), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP35218
Size: 20 µg
Source: HEK293T

Product Name

CA5A (NM_001739) Human Recombinant Protein

View all Carbonic Anhydrase VA/CA5A recombinant proteins

SKU/Catalog Number

PROTP35218

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human carbonic anhydrase VA, mitochondrial (CA5A), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CA5A (NM_001739) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP35218)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.1 kDa

Amino Acid Sequence

MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Validation Images & Assay Conditions

Gene/Protein Information For CA5A (Source: Uniprot.org, NCBI)

Gene Name

CA5A

Full Name

Carbonic anhydrase 5A, mitochondrial

Weight

30.1 kDa

Superfamily

alpha-carbonic anhydrase family

Alternative Names

CA5A; CA5carbonic anhydrase 5A, mitochondrial; Carbonate dehydratase VA; carbonic anhydrase V, mitochondrial; Carbonic Anhydrase VA; carbonic anhydrase VA, mitochondrial; carbonic dehydratase; CAV; CAVA; CA-VA; EC 4.2.1.1 CA5A CA5D, CAV, CAVA, GS1-21A4.1, CA5A carbonic anhydrase 5A carbonic anhydrase 5A, mitochondrial|CA-VA|carbonate dehydratase VA|carbonic anhydrase V, mitochondrial|carbonic anhydrase VA, mitochondrial|carbonic dehydratase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CA5A, check out the CA5A Infographic

CA5A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CA5A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP35218

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CA5A (NM_001739) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CA5A (NM_001739) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CA5A (NM_001739) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP35218
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.