C2orf43 (LDAH) (NM_021925) Human Recombinant Protein

LDAH protein,

Recombinant protein of human chromosome 2 open reading frame 43 (C2orf43)

Product Info Summary

SKU: PROTQ9H6V9
Size: 20 µg
Source: HEK293T

Product Name

C2orf43 (LDAH) (NM_021925) Human Recombinant Protein

View all LDAH recombinant proteins

SKU/Catalog Number

PROTQ9H6V9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 2 open reading frame 43 (C2orf43)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C2orf43 (LDAH) (NM_021925) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H6V9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.1 kDa

Amino Acid Sequence

MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM

Validation Images & Assay Conditions

Gene/Protein Information For LDAH (Source: Uniprot.org, NCBI)

Gene Name

LDAH

Full Name

Lipid droplet-associated hydrolase

Weight

37.1 kDa

Superfamily

AB hydrolase superfamily

Alternative Names

Lipid droplet-associated hydrolase LDAH C2orf43, hLDAH lipid droplet associated hydrolase lipid droplet-associated hydrolase|UPF0554 protein C2orf43|lipid droplet-associated serine hydrolase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LDAH, check out the LDAH Infographic

LDAH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LDAH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H6V9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C2orf43 (LDAH) (NM_021925) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C2orf43 (LDAH) (NM_021925) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C2orf43 (LDAH) (NM_021925) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H6V9
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product