C20orf30 (TMEM230) (NM_014145) Human Recombinant Protein

TMEM230 protein,

Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3

Product Info Summary

SKU: PROTQ96A57
Size: 20 µg
Source: HEK293T

Product Name

C20orf30 (TMEM230) (NM_014145) Human Recombinant Protein

View all TMEM230 recombinant proteins

SKU/Catalog Number

PROTQ96A57

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C20orf30 (TMEM230) (NM_014145) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96A57)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13 kDa

Amino Acid Sequence

MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD

Validation Images & Assay Conditions

Gene/Protein Information For TMEM230 (Source: Uniprot.org, NCBI)

Gene Name

TMEM230

Full Name

Transmembrane protein 230

Weight

13 kDa

Superfamily

TMEM134/TMEM230 family

Alternative Names

C20orf30; chromosome 20 open reading frame 30; dJ1116H23.2.1; HSPC274; hypothetical protein LOC29058; transmembrane protein 230 TMEM230 C20orf30, HSPC274, dJ1116H23.2.1 transmembrane protein 230 transmembrane protein 230|UPF0414 transmembrane protein C20orf30

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMEM230, check out the TMEM230 Infographic

TMEM230 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMEM230: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96A57

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C20orf30 (TMEM230) (NM_014145) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C20orf30 (TMEM230) (NM_014145) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C20orf30 (TMEM230) (NM_014145) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96A57
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.