C1orf41 (HSPB11) (NM_016126) Human Recombinant Protein

HSPB11 protein,

Product Info Summary

SKU: PROTQ9Y547
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C1orf41 (HSPB11) (NM_016126) Human Recombinant Protein

View all HSPB11 recombinant proteins

SKU/Catalog Number

PROTQ9Y547

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human heat shock protein family B (small), member 11 (HSPB11)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C1orf41 (HSPB11) (NM_016126) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y547)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.1 kDa

Amino Acid Sequence

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Validation Images & Assay Conditions

Gene/Protein Information For HSPB11 (Source: Uniprot.org, NCBI)

Gene Name

HSPB11

Full Name

Intraflagellar transport protein 25 homolog

Weight

16.1 kDa

Superfamily

IFT25 family

Alternative Names

C1orf41; heat shock protein beta-11; heat shock protein family B (small), member 11; Hspb11; HSPCO34; IFT25; intraflagellar transport 25 homolog; Placental protein 25; PP25chromosome 1 open reading frame 41 HSPB11 C1orf41, FAP232, HSPCO34, IFT25, PP25 heat shock protein family B (small) member 11 intraflagellar transport protein 25 homolog|heat shock protein beta-11|heat shock protein family B (small), member 11|intraflagellar transport 25 homolog|placental protein 25

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HSPB11, check out the HSPB11 Infographic

HSPB11 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSPB11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y547

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C1orf41 (HSPB11) (NM_016126) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C1orf41 (HSPB11) (NM_016126) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C1orf41 (HSPB11) (NM_016126) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y547
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.