C1orf144 (SZRD1) (NM_015609) Human Recombinant Protein

SZRD1 protein,

Recombinant protein of human chromosome 1 open reading frame 144 (C1orf144), transcript variant 2

Product Info Summary

SKU: PROTQ7Z422
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C1orf144 (SZRD1) (NM_015609) Human Recombinant Protein

View all SZRD1 recombinant proteins

SKU/Catalog Number

PROTQ7Z422

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 1 open reading frame 144 (C1orf144), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C1orf144 (SZRD1) (NM_015609) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7Z422)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.6 kDa

Amino Acid Sequence

MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNGVVSSPNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQRR

Validation Images & Assay Conditions

Gene/Protein Information For SZRD1 (Source: Uniprot.org, NCBI)

Gene Name

SZRD1

Full Name

SUZ domain-containing protein 1

Weight

14.6 kDa

Superfamily

SZRD1 family

Alternative Names

C1orf144; chromosome 1 open reading frame 144; DKFZp566C0424; MGC70432; PM21; putative MAPK activating protein PM20; Putative MAPK-activating protein PM18/PM20/PM22 SZRD1 C1orf144 SUZ RNA binding domain containing 1 SUZ domain-containing protein 1|UPF0485 protein C1orf144|putative MAPK activating protein PM20,PM21|putative MAPK-activating protein PM18/PM20/PM22

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SZRD1, check out the SZRD1 Infographic

SZRD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SZRD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7Z422

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C1orf144 (SZRD1) (NM_015609) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C1orf144 (SZRD1) (NM_015609) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C1orf144 (SZRD1) (NM_015609) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7Z422
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.