C16orf95 (NM_001195125) Human Recombinant Protein

C16orf95 protein,

Recombinant protein of human chromosome 16 open reading frame 95 (C16orf95), transcript variant 2

Product Info Summary

SKU: PROTQ9H693
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C16orf95 (NM_001195125) Human Recombinant Protein

View all C16orf95 recombinant proteins

SKU/Catalog Number

PROTQ9H693

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 16 open reading frame 95 (C16orf95), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C16orf95 (NM_001195125) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H693)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0172kDa

Amino Acid Sequence

MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKKEVCLPRHSMHPGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSSRPPTRTSYRLLQRVCCPSAS

Validation Images & Assay Conditions

Gene/Protein Information For C16orf95 (Source: Uniprot.org, NCBI)

Gene Name

C16orf95

Full Name

Uncharacterized protein C16orf95

Weight

0.0172kDa

Alternative Names

AC010531.1; chromosome 16 open reading frame 95; DKFZp434J1815; FLJ22477; hypothetical protein LOC100506581 C16orf95 chromosome 16 open reading frame 95 uncharacterized protein C16orf95

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on C16orf95, check out the C16orf95 Infographic

C16orf95 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for C16orf95: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H693

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C16orf95 (NM_001195125) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C16orf95 (NM_001195125) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C16orf95 (NM_001195125) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H693
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.