C16orf57 (USB1) (NM_024598) Human Recombinant Protein

HVSL1 protein,

Recombinant protein of human chromosome 16 open reading frame 57 (C16orf57)

Product Info Summary

SKU: PROTQ9BQ65
Size: 20 µg
Source: HEK293T

Product Name

C16orf57 (USB1) (NM_024598) Human Recombinant Protein

View all HVSL1 recombinant proteins

SKU/Catalog Number

PROTQ9BQ65

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 16 open reading frame 57 (C16orf57)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C16orf57 (USB1) (NM_024598) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BQ65)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.1 kDa

Amino Acid Sequence

MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK

Validation Images & Assay Conditions

Gene/Protein Information For USB1 (Source: Uniprot.org, NCBI)

Gene Name

USB1

Full Name

U6 snRNA phosphodiesterase

Weight

30.1 kDa

Superfamily

2H phosphoesterase superfamily

Alternative Names

C16orf57; chromosome 16 open reading frame 57; FLJ13154; HVSL motif containing 1; HVSL1; hypothetical protein LOC79650; PN USB1 C16orf57, HVSL1, Mpn1, PN, hUsb1 U6 snRNA biogenesis phosphodiesterase 1 U6 snRNA phosphodiesterase|HVSL motif containing 1|U six biogenesis 1|U6 snRNA biogenesis 1|UPF0406 protein C16orf57|mutated in poikiloderma with neutropenia protein 1|putative U6 snRNA phosphodiesterase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on USB1, check out the USB1 Infographic

USB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for USB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BQ65

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C16orf57 (USB1) (NM_024598) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C16orf57 (USB1) (NM_024598) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C16orf57 (USB1) (NM_024598) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BQ65
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.