C14orf177 (NM_182560) Human Recombinant Protein

C14orf177 protein,

Recombinant protein of human chromosome 14 open reading frame 177 (C14orf177)

Product Info Summary

SKU: PROTQ52M58
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C14orf177 (NM_182560) Human Recombinant Protein

View all C14orf177 recombinant proteins

SKU/Catalog Number

PROTQ52M58

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 14 open reading frame 177 (C14orf177)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C14orf177 (NM_182560) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ52M58)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.7 kDa

Amino Acid Sequence

MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQM

Validation Images & Assay Conditions

Gene/Protein Information For C14orf177 (Source: Uniprot.org, NCBI)

Gene Name

C14orf177

Full Name

Putative uncharacterized protein C14orf177

Weight

13.7 kDa

Alternative Names

chromosome 14 open reading frame 177; FLJ25773; hypothetical protein LOC283598; putative uncharacterized protein C14orf177 LINC02914 C14orf177 long intergenic non-protein coding RNA 2914

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on C14orf177, check out the C14orf177 Infographic

C14orf177 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for C14orf177: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used C14orf177 (NM_182560) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C14orf177 (NM_182560) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C14orf177 (NM_182560) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ52M58
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.