C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein

FAM164C protein,

Recombinant protein of human family with sequence similarity 164, member C (FAM164C), transcript variant 2

Product Info Summary

SKU: PROTQ53FD0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein

View all FAM164C recombinant proteins

SKU/Catalog Number

PROTQ53FD0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 164, member C (FAM164C), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ53FD0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.9 kDa

Amino Acid Sequence

MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYTHPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG

Validation Images & Assay Conditions

Gene/Protein Information For ZC2HC1C (Source: Uniprot.org, NCBI)

Gene Name

ZC2HC1C

Full Name

Zinc finger C2HC domain-containing protein 1C

Weight

30.9 kDa

Superfamily

ZC2HC1 family

Alternative Names

C14orf140; chromosome 14 open reading frame 140; family with sequence similarity 164, member C; FLJ23093

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZC2HC1C, check out the ZC2HC1C Infographic

ZC2HC1C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZC2HC1C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ53FD0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ53FD0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.