BAGE2 (NM_182482) Human Recombinant Protein

BAGE2 protein,

Recombinant protein of human B melanoma antigen family, member 2 (BAGE2)

Product Info Summary

SKU: PROTQ86Y30
Size: 20 µg
Source: HEK293T

Product Name

BAGE2 (NM_182482) Human Recombinant Protein

View all BAGE2 recombinant proteins

SKU/Catalog Number

PROTQ86Y30

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human B melanoma antigen family, member 2 (BAGE2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BAGE2 (NM_182482) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86Y30)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12 kDa

Amino Acid Sequence

MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS

Validation Images & Assay Conditions

Gene/Protein Information For BAGE2 (Source: Uniprot.org, NCBI)

Gene Name

BAGE2

Full Name

B melanoma antigen 2

Weight

12 kDa

Superfamily

BAGE family

Alternative Names

B melanoma antigen 2 BAGE2 CT2.2 BAGE family member 2 B melanoma family member 2|cancer/testis 2.2|cancer/testis family 2, member 2|histone-lysine N-methyltransferase 2C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BAGE2, check out the BAGE2 Infographic

BAGE2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BAGE2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ86Y30

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BAGE2 (NM_182482) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BAGE2 (NM_182482) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BAGE2 (NM_182482) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86Y30
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.