Anti-NADPH oxidase 4/NOX4 Antibody Picoband™

Nox4 antibody

Boster Bio Anti-NADPH oxidase 4/NOX4 Antibody Picoband™ catalog # A00403. Tested in IF, ICC, WB applications. This antibody reacts with Human, Monkey. Cited in 6 publication(s).

Product Info Summary

SKU: A00403
Size: 100 μg/vial
Reactive Species: Human, Monkey
Host: Rabbit
Application: IF, ICC, WB

Product Name

Anti-NADPH oxidase 4/NOX4 Antibody Picoband™

View all Nox4 Antibodies

SKU/Catalog Number

A00403

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-NADPH oxidase 4/NOX4 Antibody Picoband™ catalog # A00403. Tested in IF, ICC, WB applications. This antibody reacts with Human, Monkey.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-NADPH oxidase 4/NOX4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00403)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human NADPH oxidase 4, which shares 97.2% amino acid (aa) sequence identity with both mouse and rat NADPH oxidase 4.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00403 is reactive to Nox4 in Human, Monkey

Applications

A00403 is guaranteed for IF, ICC, WB Boster Guarantee

Observed Molecular Weight

65 kDa

Calculated molecular weight

62378 MW

Background of Nox4

NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunocytochemistry/Immunofluorescence, 5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For Nox4 (Source: Uniprot.org, NCBI)

Gene Name

Nox4

Full Name

NADPH oxidase 4

Weight

62378 MW

Alternative Names

EC 1.6.3; Kidney oxidase-1; Kidney superoxide-producing NADPH oxidase; KOX; KOX-1; KOX-1Renal NAD(P)H-oxidase; NADPH oxidase 4; Nox4; RENOX; RENOXEC 1.6.3.- Nox4|AI648021|NADPH oxidase 4|NADPH oxidase 4|KOX-1|kidney oxidase-1|kidney superoxide-producing NADPH oxidase|renal NAD(P)H-oxidase|superoxide-generating NADPH oxidase 4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Nox4, check out the Nox4 Infographic

Nox4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Nox4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00403 has been cited in 6 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Suppression of Oxidative Stress and Apoptosis in Electrically Stimulated Neonatal Rat Cardiomyocytes by Resveratrol and Underlying Mechanisms

Bletilla striata polysaccharide inhibits angiotensin II-induced ROS and inflammation via NOX4 and TLR2 pathways

Polydatin protects against carbon tetrachloride-induced liver fibrosis in mice

Wang D,Yan Z,Bu L,An C,Deng B,Zhang J,Rao J,Cheng L,Zhang J,Zhang B,Xie J.Protective effect of peptide DR8 on bleomycin-induced pulmonary fibrosis by regulating the TGF-β/MAPK signaling pathway and oxidative stress.Toxicol Appl Pharmacol.2019 Nov 1;382:114703.doi:10.1016/j.taap.2019.114703.Epub 2019 Aug 6.PMID:31398421.
Species: Mouse
A00403 usage in article: APP:WB, SAMPLE:NIH3T3 CELL AND A549 CELL, DILUTION:1:200

Deficiency of NOX1 or NOX4 Prevents Liver Inflammation and Fibrosis in Mice through Inhibition of Hepatic Stellate Cell Activation

Obligatory role for GPER in cardiovascular aging and disease^

Have you used Anti-NADPH oxidase 4/NOX4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-NADPH oxidase 4/NOX4 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-NADPH oxidase 4/NOX4 Antibody Picoband™

Question

Our lab were content with the WB result of your anti-NADPH oxidase 4/NOX4 antibody. However we have observed positive staining in ovary endoplasmic reticulum membrane using this antibody. Is that expected? Could you tell me where is NOX4 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-03-31

Answer

According to literature, ovary does express NOX4. Generally NOX4 expresses in endoplasmic reticulum membrane. Regarding which tissues have NOX4 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Pubmed ID: 11376945
Kidney, Pubmed ID: 10869423, 11032835
Lung, Pubmed ID: 15721269
Ovary, Pubmed ID: 15489334
Pulmonary artery, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-03-31

Question

Is this A00403 anti-NADPH oxidase 4/NOX4 antibody reactive to the isotypes of NOX4?

B. Williams

Verified customer

Asked: 2020-03-02

Answer

The immunogen of A00403 anti-NADPH oxidase 4/NOX4 antibody is A synthetic peptide corresponding to a sequence of human NADPH oxidase 4 (ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-02

Question

Will A00403 anti-NADPH oxidase 4/NOX4 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-12-24

Answer

It shows on the product datasheet, A00403 anti-NADPH oxidase 4/NOX4 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-12-24

Question

Is a blocking peptide available for product anti-NADPH oxidase 4/NOX4 antibody (A00403)?

Verified Customer

Verified customer

Asked: 2019-12-17

Answer

We do provide the blocking peptide for product anti-NADPH oxidase 4/NOX4 antibody (A00403). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-17

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for nephron tubule using anti-NADPH oxidase 4/NOX4 antibody A00403. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-12-11

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-11

Question

Do you have a BSA free version of anti-NADPH oxidase 4/NOX4 antibody A00403 available?

Verified Customer

Verified customer

Asked: 2019-11-26

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-NADPH oxidase 4/NOX4 antibody A00403 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-26

Question

I was wanting to use your anti-NADPH oxidase 4/NOX4 antibody for IHC for rat nephron tubule on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat nephron tubule identification?

Verified Customer

Verified customer

Asked: 2019-10-08

Answer

As indicated on the product datasheet, A00403 anti-NADPH oxidase 4/NOX4 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat nephron tubule in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-08

Question

We are currently using anti-NADPH oxidase 4/NOX4 antibody A00403 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?

J. Johnson

Verified customer

Asked: 2019-07-03

Answer

The anti-NADPH oxidase 4/NOX4 antibody (A00403) has not been tested for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-03

Question

We have been able to see staining in rat pulmonary artery. What should we do? Is anti-NADPH oxidase 4/NOX4 antibody supposed to stain pulmonary artery positively?

Verified Customer

Verified customer

Asked: 2019-05-14

Answer

Based on literature pulmonary artery does express NOX4. Based on Uniprot.org, NOX4 is expressed in nephron tubule, kidney, fetal kidney, lung, pulmonary artery, ovary, among other tissues. Regarding which tissues have NOX4 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Pubmed ID: 11376945
Kidney, Pubmed ID: 10869423, 11032835
Lung, Pubmed ID: 15721269
Ovary, Pubmed ID: 15489334
Pulmonary artery, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-05-14

Question

I have a question about product A00403, anti-NADPH oxidase 4/NOX4 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

A. Gonzalez

Verified customer

Asked: 2019-01-29

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00403 anti-NADPH oxidase 4/NOX4 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-01-29

Question

I am interested in to test anti-NADPH oxidase 4/NOX4 antibody A00403 on rat nephron tubule for research purposes, then I may be interested in using anti-NADPH oxidase 4/NOX4 antibody A00403 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-01-15

Answer

The products we sell, including anti-NADPH oxidase 4/NOX4 antibody A00403, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-01-15

Question

We need using your anti-NADPH oxidase 4/NOX4 antibody for positive regulation of reactive oxygen species metabolic process studies. Has this antibody been tested with western blotting on rat kidney tissue? We would like to see some validation images before ordering.

A. Carter

Verified customer

Asked: 2018-06-19

Answer

Thanks for your inquiry. This A00403 anti-NADPH oxidase 4/NOX4 antibody is validated on human hela, hela whole cell lysates, hepg2 whole cell lysates, a549 whole cell lysates, 293t whole cell lysates, rat kidney tissue, nrk whole cell lysates, mouse kidney tissue, renal cancer tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-06-19

Question

See attached the WB image, lot number and protocol we used for nephron tubule using anti-NADPH oxidase 4/NOX4 antibody A00403. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-05-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-05-29

Question

I see that the anti-NADPH oxidase 4/NOX4 antibody A00403 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2017-11-06

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-11-06

Question

Does anti-NADPH oxidase 4/NOX4 antibody A00403 work for IHC with nephron tubule?

R. Jones

Verified customer

Asked: 2015-02-05

Answer

According to the expression profile of nephron tubule, NOX4 is highly expressed in nephron tubule. So, it is likely that anti-NADPH oxidase 4/NOX4 antibody A00403 will work for IHC with nephron tubule.

Boster Scientific Support

Answered: 2015-02-05

Question

We bought anti-NADPH oxidase 4/NOX4 antibody for WB on nephron tubule a few years ago. I am using rat, and I plan to use the antibody for IHC next. Our lab want to know about examining nephron tubule as well as lung in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?

T. Krishna

Verified customer

Asked: 2013-05-24

Answer

I viewed the website and datasheets of our anti-NADPH oxidase 4/NOX4 antibody and I see that A00403 has been tested on rat in both WB and IHC. Thus A00403 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2013-05-24

Order DetailsPrice
A00403

100μg

$370
A00403-10ug

10μg sample (liquid)

$99
A00403-Biotin

100 μg Biotin conjugated

$570
A00403-Cy3

100 μg Cy3 conjugated

$570
A00403-Dylight488

100 μg Dylight488 conjugated

$570
A00403-Dylight550

100 μg Dylight550 conjugated

$570
A00403-Dylight594

100 μg Dylight594 conjugated

$570
A00403-FITC

100 μg FITC conjugated

$570
A00403-HRP

100 μg HRP conjugated

$570
A00403-APC

100 μg APC conjugated

$670
A00403-PE

100 μg PE conjugated

$670
A00403-iFluor647

100 μg iFluor647 conjugated

$670
A00403-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00403
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.