Anti-LRIG3 Picoband™ Antibody

SKU PB10077
Size 100μg/vial
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Ig Isotype N/A
Applications WB


Product Name Anti-LRIG3 Picoband™ Antibody
SKU/Catalog Number PB10077
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Size 100μg/vial
Description Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human;Rat.
Cite This Product Anti-LRIG3 Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10077)
Host Rabbit
Contents/Buffer Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Form Lyophilized
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.
Reactivity Human, Rat

Assay Details

Assay Dilutions Overview

Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Western blot, 0.1-0.5μg/ml, Human, Rat

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Images And Assay Conditions

Western blot analysis of LRIG3 expression in rat testis extract (lane 1) and HEPG2 whole cell lysates (lane 2). LRIG3 at 123KD was detected using rabbit anti- LRIG3 Antigen Affinity purified polyclonal antibody (Catalog # PB10077) at 0.5 ??g/mL. The blot

Target Info

Protein Target Info (Source:

Uniprot Id Q6UXM1
Gene Name LRIG3
Protein Name Leucine-rich repeats and immunoglobulin-like domains protein 3
Tissue Specificity Widely expressed. .
Alternative Names Leucine-rich repeats and immunoglobulin-like domains protein 3;LIG-3;LRIG3;LIG3;UNQ287/PRO326/PRO335;
Subcellular Localization Cell membrane ; Single-pass type I membrane protein . Cytoplasmic vesicle membrane ; Single-pass type I membrane protein . Detected in cytoplasmic vesicles when coexpressed with ERBB4. .
Molecular Weight 123434 MW

*if product is indicated to react with multiple species, protein info is based on the human gene.


Protein Function May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1 (By similarity). .
Research Areas Human, Rat

*You can search these to find other products in these research areas.
Background LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Write Your Own Review
Only registered users can write reviews. Please Sign in or create an account
In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Write a review for PB10077

Customer Q&As

  • Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
    A: Yes, please contact us at [email protected] for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
  • Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
    A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact [email protected]
  • Q: What should I use for negative control?
    A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
  • Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
    A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
  • Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
    A: You can find the immunogen sequence under "
  • Q: What is the expected band size? Why is it different than the observed band size?
    A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:<br>1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected<br>2. Post-translational cleavage: this can cause smaller bands and or multiple bands <br><br>3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody. <br><br>4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.<br>5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher., <br>
  • Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
    A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
  • Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
    A: Check our protocols under the tech support tab.
Copyright © 2019 Boster Biological Technology Inc. All rights reserved.