Anti-Fascin/FSCN1 Antibody Picoband™

Fascin antibody

Boster Bio Anti-Fascin/FSCN1 Antibody Picoband™ catalog # PB9592. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: PB9592
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Fascin/FSCN1 Antibody Picoband™

View all Fascin Antibodies

SKU/Catalog Number

PB9592

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Fascin/FSCN1 Antibody Picoband™ catalog # PB9592. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Fascin/FSCN1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9592)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin, identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9592 is reactive to FSCN1 in Human, Mouse, Rat

Applications

PB9592 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

55 kDa

Calculated molecular weight

54530 MW

Background of Fascin

Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For FSCN1 (Source: Uniprot.org, NCBI)

Gene Name

FSCN1

Full Name

Fascin

Weight

54530 MW

Superfamily

fascin family

Alternative Names

FAN1; FAN1,55 kDa actin-bundling protein; fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus); Fascin; FLJ38511; FSCN1; HSN; p55actin bundling protein; singed (Drosophila)-like (sea urchin fascin homolog like); singed-like (fascin homolog, sea urchin); Singed-like Protein; SNL; SNLfascin FSCN1 FAN1, HSN, SNL, p55 fascin actin-bundling protein 1 fascin|55 kDa actin-bundling protein|epididymis secretory sperm binding protein|fascin homolog 1, actin-bundling protein|singed-like (fascin homolog, sea urchin)

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on FSCN1, check out the FSCN1 Infographic

FSCN1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FSCN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9592 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Jiang L, Wang P, Chen H. Ups J Med Sci. 2014 Nov;119(4):324-32. Doi: 10.3109/03009734.2014.960053. Epub 2014 Sep 18. Overexpression Of Foxm1 Is Associated With Metastases Of Nasopharyngeal Carcinoma.

Have you used Anti-Fascin/FSCN1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Fascin/FSCN1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Fascin/FSCN1 Antibody Picoband™

Question

Is there a BSA free version of anti-Fascin/FSCN1 antibody PB9592 available?

Verified Customer

Verified customer

Asked: 2020-03-30

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Fascin/FSCN1 antibody PB9592 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-30

Question

We have seen staining in rat epithelium of bronchus. Any tips? Is anti-Fascin/FSCN1 antibody supposed to stain epithelium of bronchus positively?

Verified Customer

Verified customer

Asked: 2020-02-26

Answer

Based on literature epithelium of bronchus does express FSCN1. Based on Uniprot.org, FSCN1 is expressed in epithelium of bronchus, teratocarcinoma, testis, brain, eye, lung muscle, ovarian carcinoma, brain, cajal-retzius cell fetal brain cortex, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have FSCN1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 3525578
Brain, Eye, Lung, and Muscle, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Teratocarcinoma, Pubmed ID: 8068206
Testis, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-02-26

Question

I am interested in to test anti-Fascin/FSCN1 antibody PB9592 on human liver for research purposes, then I may be interested in using anti-Fascin/FSCN1 antibody PB9592 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-02-11

Answer

The products we sell, including anti-Fascin/FSCN1 antibody PB9592, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-02-11

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-Fascin/FSCN1 antibody PB9592. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-12-31

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-31

Question

Will anti-Fascin/FSCN1 antibody PB9592 work for WB with liver?

Verified Customer

Verified customer

Asked: 2019-07-18

Answer

According to the expression profile of liver, FSCN1 is highly expressed in liver. So, it is likely that anti-Fascin/FSCN1 antibody PB9592 will work for WB with liver.

Boster Scientific Support

Answered: 2019-07-18

Question

See attached the WB image, lot number and protocol we used for liver using anti-Fascin/FSCN1 antibody PB9592. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-05-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-29

Question

Is a blocking peptide available for product anti-Fascin/FSCN1 antibody (PB9592)?

L. Edwards

Verified customer

Asked: 2019-04-24

Answer

We do provide the blocking peptide for product anti-Fascin/FSCN1 antibody (PB9592). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-04-24

Question

Our lab were satisfied with the WB result of your anti-Fascin/FSCN1 antibody. However we have been able to see positive staining in liver cytosol using this antibody. Is that expected? Could you tell me where is FSCN1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2018-05-11

Answer

From literature, liver does express FSCN1. Generally FSCN1 expresses in cytoplasm, cytosol. Regarding which tissues have FSCN1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 3525578
Brain, Eye, Lung, and Muscle, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Teratocarcinoma, Pubmed ID: 8068206
Testis, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2018-05-11

Question

you antibody using your anti-Fascin/FSCN1 antibody for microspike assembly studies. Has this antibody been tested with western blotting on hela whole cell lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-02-16

Answer

Thanks for your inquiry. This PB9592 anti-Fascin/FSCN1 antibody is validated on rat lung tissue, brain tissue, tissue lysate, hela whole cell lysate, skov whole cell lysate. It is guaranteed to work for WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-02-16

Question

Will PB9592 anti-Fascin/FSCN1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-09-13

Answer

It shows on the product datasheet, PB9592 anti-Fascin/FSCN1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-09-13

Question

I was wanting to use your anti-Fascin/FSCN1 antibody for WB for human liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human liver identification?

K. Anderson

Verified customer

Asked: 2017-05-23

Answer

As indicated on the product datasheet, PB9592 anti-Fascin/FSCN1 antibody has been tested for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-05-23

Question

Is this PB9592 anti-Fascin/FSCN1 antibody reactive to the isotypes of FSCN1?

S. Yang

Verified customer

Asked: 2016-11-18

Answer

The immunogen of PB9592 anti-Fascin/FSCN1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-11-18

Question

We are currently using anti-Fascin/FSCN1 antibody PB9592 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on horse tissues as well?

R. Evans

Verified customer

Asked: 2016-09-23

Answer

The anti-Fascin/FSCN1 antibody (PB9592) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-09-23

Question

My question regarding product PB9592, anti-Fascin/FSCN1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

C. Moore

Verified customer

Asked: 2014-08-07

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9592 anti-Fascin/FSCN1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2014-08-07

Question

I see that the anti-Fascin/FSCN1 antibody PB9592 works with WB, what is the protocol used to produce the result images on the product page?

K. Patel

Verified customer

Asked: 2013-11-01

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-11-01

Order DetailsPrice
PB9592

100μg

$370
PB9592-10ug

10μg sample (liquid)

$99
PB9592-Biotin

100 μg Biotin conjugated

$570
PB9592-Cy3

100 μg Cy3 conjugated

$570
PB9592-Dylight488

100 μg Dylight488 conjugated

$570
PB9592-Dylight550

100 μg Dylight550 conjugated

$570
PB9592-Dylight594

100 μg Dylight594 conjugated

$570
PB9592-FITC

100 μg FITC conjugated

$570
PB9592-HRP

100 μg HRP conjugated

$570
PB9592-APC

100 μg APC conjugated

$670
PB9592-PE

100 μg PE conjugated

$670
PB9592-iFluor647

100 μg iFluor647 conjugated

$670
PB9592-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9592
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.