Click image to see more details
Product Info Summary
| SKU: | PB9592 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Fascin/FSCN1 Antibody Picoband®
SKU/Catalog Number
PB9592
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Fascin/FSCN1 Antibody Picoband® catalog # PB9592. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Fascin/FSCN1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9592)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin, identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9592 is reactive to FSCN1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
55 kDa
Calculated molecular weight
54530 MW
Background of Fascin
Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9592 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: human SH-SY5Y whole cell, human Hela whole cell, human K562 whole cell, human A549 whole cell, human HepG2 whole cell, human PC-3 whole cell, rat brain tissue, mouse brain tissue, mouse NIH/3T3 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Fascin/FSCN1 using anti-Fascin/FSCN1 antibody (PB9592).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human SH-SY5Y whole cell lysates,
Lane 2: human Hela whole cell lysates,
Lane 3: human K562 whole cell lysates,
Lane 4: human A549 whole cell lysates,
Lane 5: human HepG2 whole cell lysates,
Lane 6: human PC-3 whole cell lysates,
Lane 7: rat brain tissue lysates,
Lane 8: mouse brain tissue lysates,
Lane 9: mouse NIH/3T3 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Fascin/FSCN1 antigen affinity purified polyclonal antibody (Catalog # PB9592) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Fascin/FSCN1 at approximately 55 kDa. The expected band size for Fascin/FSCN1 is at 55 kDa.
Protein Target Info & Infographic
Gene/Protein Information For FSCN1 (Source: Uniprot.org, NCBI)
Gene Name
FSCN1
Full Name
Fascin
Weight
54530 MW
Superfamily
fascin family
Alternative Names
Fascin;55 kDa actin-bundling protein;Singed-like protein;p55;FSCN1;FAN1, HSN, SNL; FSCN1 FAN1, HSN, SNL, p55 fascin actin-bundling protein 1 fascin|55 kDa actin-bundling protein|epididymis secretory sperm binding protein|fascin homolog 1, actin-bundling protein|singed-like (fascin homolog, sea urchin)
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FSCN1, check out the FSCN1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FSCN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Fascin/FSCN1 Antibody Picoband® (PB9592)
Hello CJ!
PB9592 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Jiang L, Wang P, Chen H. Ups J Med Sci. 2014 Nov;119(4):324-32. Doi: 10.3109/03009734.2014.960053. Epub 2014 Sep 18. Overexpression Of Foxm1 Is Associated With Metastases Of Nasopharyngeal Carcinoma.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Fascin/FSCN1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Fascin/FSCN1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Fascin/FSCN1 Antibody Picoband®
Question
Is there a BSA free version of anti-Fascin/FSCN1 antibody PB9592 available?
Verified Customer
Verified customer
Asked: 2020-03-30
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Fascin/FSCN1 antibody PB9592 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-03-30
Question
We have seen staining in rat epithelium of bronchus. Any tips? Is anti-Fascin/FSCN1 antibody supposed to stain epithelium of bronchus positively?
Verified Customer
Verified customer
Asked: 2020-02-26
Answer
Based on literature epithelium of bronchus does express FSCN1. Based on Uniprot.org, FSCN1 is expressed in epithelium of bronchus, teratocarcinoma, testis, brain, eye, lung muscle, ovarian carcinoma, brain, cajal-retzius cell fetal brain cortex, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have FSCN1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 3525578
Brain, Eye, Lung, and Muscle, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Teratocarcinoma, Pubmed ID: 8068206
Testis, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-02-26
Question
I am interested in to test anti-Fascin/FSCN1 antibody PB9592 on human liver for research purposes, then I may be interested in using anti-Fascin/FSCN1 antibody PB9592 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-02-11
Answer
The products we sell, including anti-Fascin/FSCN1 antibody PB9592, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-02-11
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-Fascin/FSCN1 antibody PB9592. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-12-31
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-31
Question
Will anti-Fascin/FSCN1 antibody PB9592 work for WB with liver?
Verified Customer
Verified customer
Asked: 2019-07-18
Answer
According to the expression profile of liver, FSCN1 is highly expressed in liver. So, it is likely that anti-Fascin/FSCN1 antibody PB9592 will work for WB with liver.
Boster Scientific Support
Answered: 2019-07-18
Question
See attached the WB image, lot number and protocol we used for liver using anti-Fascin/FSCN1 antibody PB9592. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-05-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-05-29
Question
Is a blocking peptide available for product anti-Fascin/FSCN1 antibody (PB9592)?
L. Edwards
Verified customer
Asked: 2019-04-24
Answer
We do provide the blocking peptide for product anti-Fascin/FSCN1 antibody (PB9592). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-04-24
Question
Our lab were satisfied with the WB result of your anti-Fascin/FSCN1 antibody. However we have been able to see positive staining in liver cytosol using this antibody. Is that expected? Could you tell me where is FSCN1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2018-05-11
Answer
From literature, liver does express FSCN1. Generally FSCN1 expresses in cytoplasm, cytosol. Regarding which tissues have FSCN1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 3525578
Brain, Eye, Lung, and Muscle, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Teratocarcinoma, Pubmed ID: 8068206
Testis, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2018-05-11
Question
you antibody using your anti-Fascin/FSCN1 antibody for microspike assembly studies. Has this antibody been tested with western blotting on hela whole cell lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2018-02-16
Answer
Thanks for your inquiry. This PB9592 anti-Fascin/FSCN1 antibody is validated on rat lung tissue, brain tissue, tissue lysate, hela whole cell lysate, skov whole cell lysate. It is guaranteed to work for WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-02-16
Question
Will PB9592 anti-Fascin/FSCN1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-09-13
Answer
It shows on the product datasheet, PB9592 anti-Fascin/FSCN1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-09-13
Question
I was wanting to use your anti-Fascin/FSCN1 antibody for WB for human liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human liver identification?
K. Anderson
Verified customer
Asked: 2017-05-23
Answer
As indicated on the product datasheet, PB9592 anti-Fascin/FSCN1 antibody has been tested for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human liver in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-05-23
Question
Is this PB9592 anti-Fascin/FSCN1 antibody reactive to the isotypes of FSCN1?
S. Yang
Verified customer
Asked: 2016-11-18
Answer
The immunogen of PB9592 anti-Fascin/FSCN1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-11-18
Question
We are currently using anti-Fascin/FSCN1 antibody PB9592 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on horse tissues as well?
R. Evans
Verified customer
Asked: 2016-09-23
Answer
The anti-Fascin/FSCN1 antibody (PB9592) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2016-09-23
Question
My question regarding product PB9592, anti-Fascin/FSCN1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
C. Moore
Verified customer
Asked: 2014-08-07
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9592 anti-Fascin/FSCN1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2014-08-07
Question
I see that the anti-Fascin/FSCN1 antibody PB9592 works with WB, what is the protocol used to produce the result images on the product page?
K. Patel
Verified customer
Asked: 2013-11-01
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2013-11-01
