alpha Synuclein (SNCA) (NM_007308) Human Recombinant Protein

alpha-Synuclein protein,

Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112

Product Info Summary

SKU: PROTP37840
Size: 20 µg
Source: HEK293T

Product Name

alpha Synuclein (SNCA) (NM_007308) Human Recombinant Protein

View all alpha-Synuclein recombinant proteins

SKU/Catalog Number

PROTP37840

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

alpha Synuclein (SNCA) (NM_007308) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP37840)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.2 kDa

Amino Acid Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA

Validation Images & Assay Conditions

Gene/Protein Information For SNCA (Source: Uniprot.org, NCBI)

Gene Name

SNCA

Full Name

Alpha-synuclein

Weight

11.2 kDa

Superfamily

synuclein family

Alternative Names

alpha-Synuclein; Lewy body) 4; MGC110988; NACP; non A-beta component of AD amyloid; Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; non-A4 component of amyloid; PARK1; PARK4; SNCA; synuclein, alpha (non A4 component of amyloid precursor); Synuclein-alpha SNCA NACP, PARK1, PARK4, PD1 synuclein alpha alpha-synuclein|I+/--synuclein|non A-beta component of AD amyloid|synuclein alpha-140|synuclein, alpha (non A4 component of amyloid precursor)|truncated alpha synuclein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNCA, check out the SNCA Infographic

SNCA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNCA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP37840

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used alpha Synuclein (SNCA) (NM_007308) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For alpha Synuclein (SNCA) (NM_007308) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for alpha Synuclein (SNCA) (NM_007308) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP37840
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.