UTP3 (NM_020368) Human Recombinant Protein

UTP3 protein,

Recombinant protein of human UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) (UTP3)

Product Info Summary

SKU: PROTQ9NQZ2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UTP3 (NM_020368) Human Recombinant Protein

View all UTP3 recombinant proteins

SKU/Catalog Number

PROTQ9NQZ2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) (UTP3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UTP3 (NM_020368) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NQZ2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

54.4 kDa

Amino Acid Sequence

MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK

Validation Images & Assay Conditions

Gene/Protein Information For UTP3 (Source: Uniprot.org, NCBI)

Gene Name

UTP3

Full Name

Something about silencing protein 10

Weight

54.4 kDa

Superfamily

SAS10 family

Alternative Names

Charged amino acid-rich leucine zipper 1; CRL1charged amino acid rich leucine zipper 1 homolog; CRLZ1UTP3 homolog; disrupter of silencing 10; Disrupter of silencing SAS10; FLJ23256; SAS10DKFZp761F222; something about silencing protein 10; UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) UTP3 CRL1, CRLZ1, SAS10 UTP3 small subunit processome component something about silencing protein 10|UTP3 homolog|UTP3, small subunit processome component homolog|charged amino acid rich leucine zipper 1 homolog|charged amino acid-rich leucine zipper 1|disrupter of silencing 10|disrupter of silencing SAS10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UTP3, check out the UTP3 Infographic

UTP3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UTP3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NQZ2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UTP3 (NM_020368) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UTP3 (NM_020368) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UTP3 (NM_020368) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NQZ2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product