UBALD1 (NM_145253) Human Recombinant Protein

FAM100A protein,

Recombinant protein of human family with sequence similarity 100, member A (FAM100A)

Product Info Summary

SKU: PROTQ8TB05
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UBALD1 (NM_145253) Human Recombinant Protein

View all FAM100A recombinant proteins

SKU/Catalog Number

PROTQ8TB05

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 100, member A (FAM100A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBALD1 (NM_145253) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TB05)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.8 kDa

Amino Acid Sequence

MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQMMCTPANTPATPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER

Validation Images & Assay Conditions

Gene/Protein Information For UBALD1 (Source: Uniprot.org, NCBI)

Gene Name

UBALD1

Full Name

UBA-like domain-containing protein 1

Weight

18.8 kDa

Superfamily

UBALD family

Alternative Names

family with sequence similarity 100, member A; FLJ31223; FLJ32185; hypothetical protein LOC124402 UBALD1 FAM100A, PP11303 UBA like domain containing 1 UBA-like domain-containing protein 1|family with sequence similarity 100, member A|protein FAM100A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBALD1, check out the UBALD1 Infographic

UBALD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBALD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used UBALD1 (NM_145253) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBALD1 (NM_145253) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBALD1 (NM_145253) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TB05
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.