THNSL2 (NM_018271) Human Recombinant Protein

THNSL2 protein,

Recombinant protein of human threonine synthase-like 2 (S. cerevisiae) (THNSL2)

Product Info Summary

SKU: PROTQ86YJ6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

THNSL2 (NM_018271) Human Recombinant Protein

View all THNSL2 recombinant proteins

SKU/Catalog Number

PROTQ86YJ6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human threonine synthase-like 2 (S. cerevisiae) (THNSL2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

THNSL2 (NM_018271) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86YJ6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

53.9 kDa

Amino Acid Sequence

MWYVSTRGVAPRVNFEGALFSGYAPDGGLFMPEELPQLDRGTLCQWSTLSYPGLVKELCALFIGSELLPKDELNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCTTQFLQYFLEKREKHVTVVVGTSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKLSEAVTSVSVSDEAITQTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPASAAKFPEAVLAAGLTPETPAEIVALEHKETRCTLMRRGDNWMLMLRDTIEDLSRQWRSHALNTSQ

Validation Images & Assay Conditions

Gene/Protein Information For THNSL2 (Source: Uniprot.org, NCBI)

Gene Name

THNSL2

Full Name

Threonine synthase-like 2

Weight

53.9 kDa

Superfamily

threonine synthase family

Alternative Names

FLJ10916; FLJ35504; secreted osteoclastogenic factor of activated T cells; SOFAT; THNSL2; threonine synthase-like 2 (S. cerevisiae); THS2; TSH2 THNSL2 SOFAT, THS2, TSH2 threonine synthase like 2 threonine synthase-like 2|secreted osteoclastogenic factor of activated T cells

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on THNSL2, check out the THNSL2 Infographic

THNSL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for THNSL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ86YJ6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used THNSL2 (NM_018271) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For THNSL2 (NM_018271) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for THNSL2 (NM_018271) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86YJ6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product