Product Info Summary
SKU: | PROTP07200 |
---|---|
Size: | 5ug,20ug |
Origin Species: | Swine |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF
View all TGFB1 recombinant proteins
SKU/Catalog Number
PROTP07200
Size
5ug,20ug
Tag
His Tag (C-term)
Description
Transforming Growth Factors beta 1 (TGF beta 1) is the cytokine of the TGF-beta family, which is a 12.5 kDa protein containing 113 amino acid residues. TGF beta 1 is produced by white blood cell which plays an important role in inflammation, cell proliferation and differentiation. TGF beta 1 also has several functions about cancer and auto-immune diseases. TGF-beta 1 not only can activate the smad signaling but also can induce the MAPK, Rhoa and RAS.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP07200)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
44.341kDa
Molecular weight
The protein has a calculated MW of 13.73 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED₅₀ for this effect is <0.1 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile 10 mM HCl to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine TGF beta 1
Protein Target Info & Infographic
Gene/Protein Information For TGFB1 (Source: Uniprot.org, NCBI)
Gene Name
TGFB1
Full Name
Transforming growth factor beta-1 proprotein
Weight
44.341kDa
Superfamily
TGF-beta family
Alternative Names
TGF-BETA-1, TGFB1 TGFB1 CED, DPD1, IBDIMDE, LAP, TGF-beta1, TGFB, TGFbeta transforming growth factor beta 1 transforming growth factor beta-1 proprotein|TGF-beta-1|latency-associated peptide|prepro-transforming growth factor beta-1|transforming growth factor beta1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TGFB1, check out the TGFB1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TGFB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF (PROTP07200)
Hello CJ!
No publications found for PROTP07200
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question