Swine recombinant IL-4 (Interleukin-4) protein, AF

IL-4 protein, Swine

Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.

Product Info Summary

SKU: PROTQ04745
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant IL-4 (Interleukin-4) protein, AF

View all IL-4 recombinant proteins

SKU/Catalog Number

PROTQ04745

Size

5ug,20ug

Tag

His Tag (C-term)

Description

Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant IL-4 (Interleukin-4) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ04745)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

17.492kDa

Molecular weight

The protein has a calculated MW of 13.5 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.6 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IL4 (Source: Uniprot.org, NCBI)

Gene Name

IL4

Full Name

Interleukin-4

Weight

17.492kDa

Superfamily

IL-4/IL-13 family

Alternative Names

IL4 IL4 BCGF-1, BCGF1, BSF-1, BSF1, IL-4 interleukin 4 interleukin-4|B cell growth factor 1|B_cell stimulatory factor 1|binetrakin|interleukin 4 variant 2|lymphocyte stimulatory factor 1|pitrakinra

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL4, check out the IL4 Infographic

IL4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ04745

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Swine recombinant IL-4 (Interleukin-4) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant IL-4 (Interleukin-4) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant IL-4 (Interleukin-4) protein, AF

Size

Total: $154

SKU:PROTQ04745

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ04745
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product