SMCR7 (MIEF2) (NM_139162) Human Recombinant Protein

MIEF2 protein,

Recombinant protein of human Smith-Magenis syndrome chromosome region, candidate 7 (SMCR7), transcript variant 1

Product Info Summary

SKU: PROTQ96C03
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SMCR7 (MIEF2) (NM_139162) Human Recombinant Protein

View all MIEF2 recombinant proteins

SKU/Catalog Number

PROTQ96C03

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Smith-Magenis syndrome chromosome region, candidate 7 (SMCR7), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SMCR7 (MIEF2) (NM_139162) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96C03)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

49.1 kDa

Amino Acid Sequence

MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDAGTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCHFNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL

Validation Images & Assay Conditions

Gene/Protein Information For MIEF2 (Source: Uniprot.org, NCBI)

Gene Name

MIEF2

Full Name

Mitochondrial dynamics protein MID49

Weight

49.1 kDa

Superfamily

MID49/MID51 family

Alternative Names

Mitochondrial dynamics protein MID49 MIEF2 COXPD49, MID49, SMCR7 mitochondrial elongation factor 2 mitochondrial dynamics protein MID49|Smith-Magenis syndrome chromosomal region candidate gene 7 protein|Smith-Magenis syndrome chromosome region, candidate 7|mitochondrial dynamic protein MID49|mitochondrial dynamic protein of 49 kDa|mitochondrial dynamics protein of 49 kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MIEF2, check out the MIEF2 Infographic

MIEF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MIEF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used SMCR7 (MIEF2) (NM_139162) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SMCR7 (MIEF2) (NM_139162) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SMCR7 (MIEF2) (NM_139162) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96C03
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.