SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein

SFRS12IP1 protein,

Recombinant protein of human SFRS12-interacting protein 1 (SFRS12IP1)

Product Info Summary

SKU: PROTQ8N9Q2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein

View all SFRS12IP1 recombinant proteins

SKU/Catalog Number

PROTQ8N9Q2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SFRS12-interacting protein 1 (SFRS12IP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N9Q2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18 kDa

Amino Acid Sequence

MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRINEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKKEKHSSTPNSSEFSRK

Validation Images & Assay Conditions

Gene/Protein Information For SREK1IP1 (Source: Uniprot.org, NCBI)

Gene Name

SREK1IP1

Full Name

Protein SREK1IP1

Weight

18 kDa

Alternative Names

MGC131910; p18 splicing regulatory protein; p18SRP; P18SRPMGC150549; protein SFRS12IP1; protein SREK1IP1; SFRS12-interacting protein 1FLJ36754; SFRS12IP1; Splicing regulatory protein of 18 kDa; SREK1-interacting protein 1MGC150548

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SREK1IP1, check out the SREK1IP1 Infographic

SREK1IP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SREK1IP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N9Q2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.