RRP4 (EXOSC2) (NM_014285) Human Recombinant Protein

RRP4 protein,

Recombinant protein of human exosome component 2 (EXOSC2)

Product Info Summary

SKU: PROTQ13868
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RRP4 (EXOSC2) (NM_014285) Human Recombinant Protein

View all RRP4 recombinant proteins

SKU/Catalog Number

PROTQ13868

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human exosome component 2 (EXOSC2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RRP4 (EXOSC2) (NM_014285) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13868)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.6 kDa

Amino Acid Sequence

MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Validation Images & Assay Conditions

Gene/Protein Information For EXOSC2 (Source: Uniprot.org, NCBI)

Gene Name

EXOSC2

Full Name

Exosome complex component RRP4

Weight

32.6 kDa

Superfamily

RRP4 family

Alternative Names

exosome component 2Ribosomal RNA-processing protein 4; homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease(RRP4); homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease; hRrp4p; p7; RRP4exosome complex exonuclease RRP4; Rrp4p EXOSC2 RRP4, Rrp4p, SHRF, hRrp4p, p7 exosome component 2 exosome complex component RRP4|exosome complex exonuclease RRP4|homolog of yeast RRP4 (ribosomal RNA processing 4), 3 5 exoribonuclease (RRP4)|homolog of yeast RRP4 (ribosomal RNA processing 4), 3-5-exoribonuclease|ribosomal RNA-processing protein 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EXOSC2, check out the EXOSC2 Infographic

EXOSC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EXOSC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13868

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RRP4 (EXOSC2) (NM_014285) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RRP4 (EXOSC2) (NM_014285) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RRP4 (EXOSC2) (NM_014285) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13868
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product