robld3 (LAMTOR2) (NM_014017) Human Recombinant Protein

ROBLD3 protein,

Product Info Summary

SKU: PROTQ9Y2Q5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

robld3 (LAMTOR2) (NM_014017) Human Recombinant Protein

View all ROBLD3 recombinant proteins

SKU/Catalog Number

PROTQ9Y2Q5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human roadblock domain containing 3 (ROBLD3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

robld3 (LAMTOR2) (NM_014017) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2Q5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.3 kDa

Amino Acid Sequence

MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

Validation Images & Assay Conditions

Gene/Protein Information For LAMTOR2 (Source: Uniprot.org, NCBI)

Gene Name

LAMTOR2

Full Name

Ragulator complex protein LAMTOR2

Weight

13.3 kDa

Superfamily

GAMAD family

Alternative Names

ENDAP; Endosomal adaptor protein p14; HSPC003; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2; late endosomal/lysosomal adaptor, MAPK and MTOR activator 2; Late endosomal/lysosomal Mp1-interacting protein; MAPBPIPRoadblock domain-containing protein 3; MAPKSP1 adaptor protein; MAPKSP1AP; mitogen-activated protein-binding protein-interacting protein (MAPBPIP); Mitogen-activated protein-binding protein-interacting protein; p14Ragulator2; roadblock domain containing 3; ROBLD3 LAMTOR2 ENDAP, HSPC003, MAPBPIP, MAPKSP1AP, ROBLD3, Ragulator2, p14 late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 ragulator complex protein LAMTOR2|MAPBP-interacting protein|MAPKSP1 adaptor protein|endosomal adaptor protein p14|late endosomal/lysosomal Mp1-interacting protein|late endosomal/lysosomal adaptor and MAPK and MTOR activator 2|mitogen-activated protein-binding protein-interacting protein (MAPBPIP)|roadblock domain containing 3|roadblock domain-containing protein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LAMTOR2, check out the LAMTOR2 Infographic

LAMTOR2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LAMTOR2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y2Q5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used robld3 (LAMTOR2) (NM_014017) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For robld3 (LAMTOR2) (NM_014017) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for robld3 (LAMTOR2) (NM_014017) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2Q5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product