PEDS1 (NM_199129) Human Recombinant Protein

TMEM189 protein,

Recombinant protein of human transmembrane protein 189 (TMEM189)

Product Info Summary

SKU: PROTA5PLL7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PEDS1 (NM_199129) Human Recombinant Protein

View all TMEM189 recombinant proteins

SKU/Catalog Number

PROTA5PLL7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane protein 189 (TMEM189)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PEDS1 (NM_199129) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA5PLL7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31 kDa

Amino Acid Sequence

MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK

Validation Images & Assay Conditions

Gene/Protein Information For TMEM189 (Source: Uniprot.org, NCBI)

Gene Name

TMEM189

Full Name

Plasmanylethanolamine desaturase

Weight

31 kDa

Superfamily

fatty acid desaturase CarF family

Alternative Names

KUA; transmembrane protein 189; UBE2V1; ubiquitin-conjugating enzyme E2 variant 1 PEDS1 CarF, KUA, TMEM189 plasmanylethanolamine desaturase 1 plasmanylethanolamine desaturase|transmembrane protein 189

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMEM189, check out the TMEM189 Infographic

TMEM189 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMEM189: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA5PLL7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PEDS1 (NM_199129) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PEDS1 (NM_199129) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PEDS1 (NM_199129) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA5PLL7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product