Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF

TRAIL/TNFSF10 protein, Mouse

Tumor Necrosis Factor associated Apoptosis Inducing Ligand (TRAIL) is a type II membrane protein of the tumor necrosis factor (TNF) family members, moreover expressed in many adult tissues including the thymus, prostate, colon, ovary and lung. TRAIL is a 19 kDa protein containing 281 residues. Mouse TRAIL shares 70% amino acids sequence identity with human, bovine, and porcine. TRAIL to induce apoptosis in human breast carcinoma cells (MCF7) and human epithelioid carcinoma (HeLa) cell lines, by activate two death receptors of DR4 and DR5 or two decoy receptors DcR1 and DcR2.

Product Info Summary

SKU: PROTP50592-2
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF

View all TRAIL/TNFSF10 recombinant proteins

SKU/Catalog Number

PROTP50592-2

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Tumor Necrosis Factor associated Apoptosis Inducing Ligand (TRAIL) is a type II membrane protein of the tumor necrosis factor (TNF) family members, moreover expressed in many adult tissues including the thymus, prostate, colon, ovary and lung. TRAIL is a 19 kDa protein containing 281 residues. Mouse TRAIL shares 70% amino acids sequence identity with human, bovine, and porcine. TRAIL to induce apoptosis in human breast carcinoma cells (MCF7) and human epithelioid carcinoma (HeLa) cell lines, by activate two death receptors of DR4 and DR5 or two decoy receptors DcR1 and DcR2.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP50592-2)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

32.509kDa

Molecular weight

The protein has a calculated MW of 21.00 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED₅₀ for this effect is <1 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For TNFSF10 (Source: Uniprot.org, NCBI)

Gene Name

TNFSF10

Full Name

Tumor necrosis factor ligand superfamily member 10

Weight

32.509kDa

Superfamily

tumor necrosis factor family

Alternative Names

TNFSF10, Apo2 Ligand, TL2, Apo2L, CD253 TNFSF10 APO2L, Apo-2L, CD253, TL2, TNLG6A, TRAIL TNF superfamily member 10 tumor necrosis factor ligand superfamily member 10|Apo-2 ligand|TNF-related apoptosis inducing ligand TRAIL|chemokine tumor necrosis factor ligand superfamily member 10|tumor necrosis factor (ligand) family, member 10|tumor necrosis factor (ligand) superfamily, member 10|tumor necrosis factor apoptosis-inducing ligand splice variant delta|tumor necrosis factor ligand 6A|tumor necrosis factor superfamily member 10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNFSF10, check out the TNFSF10 Infographic

TNFSF10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNFSF10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP50592-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF

Size

Total: $77

SKU:PROTP50592-2

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP50592-2
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product