Product Info Summary
SKU: | PROTP07750-2 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-4 (Interleukin-4) protein, AF
View all IL-4 recombinant proteins
SKU/Catalog Number
PROTP07750-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-4 (Interleukin-4) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP07750-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
17.492kDa
Molecular weight
The protein has a calculated MW of 14.5 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce HT-2 cells proliferation. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately >1 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-4
Protein Target Info & Infographic
Gene/Protein Information For IL4 (Source: Uniprot.org, NCBI)
Gene Name
IL4
Full Name
Interleukin-4
Weight
17.492kDa
Superfamily
IL-4/IL-13 family
Alternative Names
BCGF, BCDF, B-cell Stimulating Factor (BSF-1) IL4 BCGF-1, BCGF1, BSF-1, BSF1, IL-4 interleukin 4 interleukin-4|B cell growth factor 1|B_cell stimulatory factor 1|binetrakin|interleukin 4 variant 2|lymphocyte stimulatory factor 1|pitrakinra
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL4, check out the IL4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-4 (Interleukin-4) protein, AF (PROTP07750-2)
Hello CJ!
No publications found for PROTP07750-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-4 (Interleukin-4) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-4 (Interleukin-4) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question