Mouse recombinant EGF (Epidermal growth factor) protein, AF

EGF protein, Mouse

Epidermal Growth Factors (EGF) is a member of the EGF-family of proteins. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epithelial cells, play important roles in many developmental processes including accelerate tooth eruption, inhibits gastric acid secretion, and involve in wound healing.

Product Info Summary

SKU: PROTP01132-7
Size: 100ug,500ug,1mg,5mg
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant EGF (Epidermal growth factor) protein, AF

View all EGF recombinant proteins

SKU/Catalog Number

PROTP01132-7

Size

100ug,500ug,1mg,5mg

Tag

His Tag (C-term)

Description

Epidermal Growth Factors (EGF) is a member of the EGF-family of proteins. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epithelial cells, play important roles in many developmental processes including accelerate tooth eruption, inhibits gastric acid secretion, and involve in wound healing.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant EGF (Epidermal growth factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01132-7)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

133.994kDa

Molecular weight

The protein has a calculated MW of 6.98 kDa. The protein migrates as 8 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <80 pg/mL. The specific activity of recombinant mouse EGF is approximately >1 x 10⁷ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For EGF (Source: Uniprot.org, NCBI)

Gene Name

EGF

Full Name

Pro-epidermal growth factor

Weight

133.994kDa

Alternative Names

Urogastrone, URG EGF HOMG4, URG epidermal growth factor pro-epidermal growth factor|beta-urogastrone

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EGF, check out the EGF Infographic

EGF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EGF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01132-7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant EGF (Epidermal growth factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant EGF (Epidermal growth factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant EGF (Epidermal growth factor) protein, AF

Size

Total: $77

SKU:PROTP01132-7

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP01132-7
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product