LRRC10 (NM_201550) Human Recombinant Protein

Lrrc10 protein,

Recombinant protein of human leucine rich repeat containing 10 (LRRC10)

Product Info Summary

SKU: PROTQ5BKY1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LRRC10 (NM_201550) Human Recombinant Protein

View all Lrrc10 recombinant proteins

SKU/Catalog Number

PROTQ5BKY1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human leucine rich repeat containing 10 (LRRC10)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LRRC10 (NM_201550) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5BKY1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.5 kDa

Amino Acid Sequence

MGNTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLSDNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLLQNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLTDFPTVLLHMPFLEVIDVDWNSIRYFPSLAHLSSLKLVIYDHNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS

Validation Images & Assay Conditions

Gene/Protein Information For LRRC10 (Source: Uniprot.org, NCBI)

Gene Name

LRRC10

Full Name

Leucine-rich repeat-containing protein 10

Weight

31.5 kDa

Alternative Names

Leucine-rich repeat-containing protein 10 Lrrc10|D330003I11Rik, H, Hrlrrp, Ser, Serdin1|leucine rich repeat containing 10|leucine-rich repeat-containing protein 10|heart-restricted leucine-rich repeat protein|leucine-rich containing 10|leucine-rich repeat protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LRRC10, check out the LRRC10 Infographic

LRRC10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LRRC10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used LRRC10 (NM_201550) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LRRC10 (NM_201550) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LRRC10 (NM_201550) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5BKY1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.