Leptin (LEP) (NM_000230) Human Recombinant Protein

Leptin/OB protein,

Product Info Summary

SKU: PROTP41159
Size: 20 µg
Source: HEK293T

Product Name

Leptin (LEP) (NM_000230) Human Recombinant Protein

View all Leptin/OB recombinant proteins

SKU/Catalog Number

PROTP41159

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human leptin (LEP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Leptin (LEP) (NM_000230) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP41159)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16 kDa

Amino Acid Sequence

MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Validation Images & Assay Conditions

Gene/Protein Information For LEP (Source: Uniprot.org, NCBI)

Gene Name

LEP

Full Name

Leptin

Weight

16 kDa

Superfamily

leptin family

Alternative Names

FLJ94114; LEP; leptin (murine obesity homolog); leptin (obesity homolog, mouse); Leptin; OB; Obese protein; obese, mouse, homolog of; Obesity factor; OBOBS LEP LEPD, OB, OBS leptin leptin|leptin (murine obesity homolog)|leptin (obesity homolog, mouse)|obese protein|obese, mouse, homolog of|obesity factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LEP, check out the LEP Infographic

LEP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LEP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP41159

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Leptin (LEP) (NM_000230) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Leptin (LEP) (NM_000230) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Leptin (LEP) (NM_000230) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP41159
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product