KCTD14 (NM_023930) Human Recombinant Protein

KCTD14 protein,

Recombinant protein of human potassium channel tetramerisation domain containing 14 (KCTD14)

Product Info Summary

SKU: PROTQ9BQ13
Size: 20 µg
Source: HEK293T

Product Name

KCTD14 (NM_023930) Human Recombinant Protein

View all KCTD14 recombinant proteins

SKU/Catalog Number

PROTQ9BQ13

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human potassium channel tetramerisation domain containing 14 (KCTD14)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KCTD14 (NM_023930) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BQ13)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.4 kDa

Amino Acid Sequence

MSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDNSDLMHCLEMDIKAQGYKVFSKFYLTYPTKRNEFHFNIYSFTFTWW

Validation Images & Assay Conditions

Gene/Protein Information For KCTD14 (Source: Uniprot.org, NCBI)

Gene Name

KCTD14

Full Name

BTB/POZ domain-containing protein KCTD14

Weight

29.4 kDa

Alternative Names

BTB/POZ domain-containing protein KCTD14; MGC2376; potassium channel tetramerisation domain containing 14 KCTD14 potassium channel tetramerization domain containing 14 BTB/POZ domain-containing protein KCTD14|potassium channel tetramerisation domain containing 14

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KCTD14, check out the KCTD14 Infographic

KCTD14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KCTD14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BQ13

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KCTD14 (NM_023930) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KCTD14 (NM_023930) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KCTD14 (NM_023930) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BQ13
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.