Interferon alpha 2 (IFNA2) (NM_000605) Human Recombinant Protein

IFNA2 protein,

Product Info Summary

SKU: PROTP01563
Size: 20 µg
Source: HEK293T

Product Name

Interferon alpha 2 (IFNA2) (NM_000605) Human Recombinant Protein

View all IFNA2 recombinant proteins

SKU/Catalog Number

PROTP01563

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interferon, alpha 2 (IFNA2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Interferon alpha 2 (IFNA2) (NM_000605) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01563)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.4 kDa

Amino Acid Sequence

MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Validation Images & Assay Conditions

Gene/Protein Information For IFNA2 (Source: Uniprot.org, NCBI)

Gene Name

IFNA2

Full Name

Interferon alpha-2

Weight

21.4 kDa

Superfamily

alpha/beta interferon family

Alternative Names

IFNA; IFNA2; IFNA2b; IFNalpha; IFN-alpha; IFN-alphaA; INFA2; interferon alpha 2; LeIF D IFNA2 IFN-alpha-2, IFN-alphaA, IFNAB, leIF A, IFNA2 interferon alpha 2 interferon alpha-2|alpha-2a interferon|interferon alpha 2a|interferon alpha 2b|interferon alpha A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFNA2, check out the IFNA2 Infographic

IFNA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFNA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Interferon alpha 2 (IFNA2) (NM_000605) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Interferon alpha 2 (IFNA2) (NM_000605) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Interferon alpha 2 (IFNA2) (NM_000605) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01563
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.