Click image to see more details
Product Info Summary
| SKU: | PROTQ15465-6 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant Sonic Hedgehog (C24II) protein, AF
View all Sonic Hedgehog/Shh recombinant proteins
SKU/Catalog Number
PROTQ15465-6
Size
5ug,20ug,100ug
Tag
His-SUMO Tag (N-term)
Description
Sonic hedgehog protein (SHH) plays a critical role in development of embryonic morphogenesis which mediate the process of organogenesis and central nervous system. The sonic hedgehog signal pathway also plays an important role in cancerous tumors like embryonic cerebellar tumor, prostate cancer tumours and medulloblastoma. Shh binds the receptor (Ptc1) that induce the smo protein to activate the downstream pathway, which induce the shh target gene expression.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Sonic Hedgehog (C24II) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15465-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
49.607kDa
Molecular weight
The protein has a calculated MW of 31.86 kDa. The protein migrates as 35-45 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Sonic Hedgehog (C24II)
Protein Target Info & Infographic
Gene/Protein Information For SHH (Source: Uniprot.org, NCBI)
Gene Name
SHH
Full Name
Sonic hedgehog protein
Weight
49.607kDa
Superfamily
hedgehog family
Alternative Names
SHH, TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5 SHH HHG1, HLP3, HPE3, MCOPCB5, SMMCI, ShhNC, TPT, TPTPS sonic hedgehog signaling molecule sonic hedgehog protein|shh unprocessed N-terminal signaling and C-terminal autoprocessing domains|sonic hedgehog homolog
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on SHH, check out the SHH Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SHH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant Sonic Hedgehog (C24II) protein, AF (PROTQ15465-6)
Hello CJ!
No publications found for PROTQ15465-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Sonic Hedgehog (C24II) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Sonic Hedgehog (C24II) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
