Click image to see more details
Product Info Summary
| SKU: | PROTQ9H293-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-25 (Interleukin-25) protein, AF
View all IL-17E/IL-25 recombinant proteins
SKU/Catalog Number
PROTQ9H293-3
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 25 (IL-25) is a cytokine with proinflammatory and anti-inflammatory effects, it predicts a molecular mass of 16.7 kDa. It can induce NF-κB activation, and stimulate the production of IL-8, which is the major chemotactic substance of neutrophils.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-25 (Interleukin-25) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H293-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
20.33kDa
Molecular weight
The protein has a calculated MW of 17.68 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <5 ng/mL. Measure by its ability to induce CXCL1 secretion in HT29 cells. The ED₅₀ for this effect is <1 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-25
Protein Target Info & Infographic
Gene/Protein Information For IL25 (Source: Uniprot.org, NCBI)
Gene Name
IL25
Full Name
Interleukin-25
Weight
20.33kDa
Superfamily
IL-17 family
Alternative Names
IL17E IL25 IL17E interleukin 25 interleukin-25|interleukin-17E
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL25, check out the IL25 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL25: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-25 (Interleukin-25) protein, AF (PROTQ9H293-3)
Hello CJ!
No publications found for PROTQ9H293-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-25 (Interleukin-25) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-25 (Interleukin-25) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
