Click image to see more details
Product Info Summary
| SKU: | PROTP01344-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IGF-II (Insulin-like growth factor-II) protein, AF
View all IGF-II/IGF2 recombinant proteins
SKU/Catalog Number
PROTP01344-3
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Insulin like Growth Factors 2 (IGF-II) is a 7.48 kDa member of the Insulin-like Growth Factors with 67 amino acid residues. IGF-II is mainly expressed from placenta, extravillous trophoblasts, leydig cells, syncytiotrophoblasts, cytotrophoblasts, peritubular cells. IGF-II regulating fetoplacental development and tissue differentiation. In adults, IGF-II signaling involves glucose metabolism in adipose tissue, skeletal muscle and liver. It also has important implications for metabolic disorders and cancer.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IGF-II (Insulin-like growth factor-II) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01344-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
20.14kDa
Molecular weight
The protein has a calculated MW of 8.28 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <3 ng/mL. The specific activity of recombinant human IGF-II is > 3x 10⁵ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IGF-II
Protein Target Info & Infographic
Gene/Protein Information For IGF2 (Source: Uniprot.org, NCBI)
Gene Name
IGF2
Full Name
Insulin-like growth factor II
Weight
20.14kDa
Superfamily
insulin family
Alternative Names
Somatamedin A IGF2 C11orf43, GRDF, IGF-II, PP9974, SRS3 insulin like growth factor 2 insulin-like growth factor II|T3M-11-derived growth factor|insulin-like growth factor 2 (somatomedin A)|insulin-like growth factor type 2|preptin
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IGF2, check out the IGF2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IGF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IGF-II (Insulin-like growth factor-II) protein, AF (PROTP01344-3)
Hello CJ!
No publications found for PROTP01344-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IGF-II (Insulin-like growth factor-II) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IGF-II (Insulin-like growth factor-II) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
