Click image to see more details
Product Info Summary
| SKU: | PROTQ05315-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant Galectin-10 protein, AF
View all Galectin-10 recombinant proteins
SKU/Catalog Number
PROTQ05315-2
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Galectin-10 (Gal-10) is a lectin family member and is one of the prototype galectins. It contains one carbohydrate recognition domain (CRD), responsible for β-galactoside binding, and is biologically active as homodimers. It has been reported that galectin-10 is presented in eosinophils but also detected in basophils and macrophages. Accumulated evidence indicates that galectin-10 spontaneously forms Charcot-Leyden crystals (CLCs), participating in allergic responses and related inflammatory reactions. Several binding partners for galectin-10 have been identified, including eosinophil granule cationic ribonucleases, eosinophil-derived neurotoxin (EDN, RNS2), and eosinophil cationic protein (ECP, RNS3), demonstrating the interaction is essential for eosinophil differentiation and granulogenesis.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Galectin-10 protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ05315-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
16.453kDa
Molecular weight
The protein has a calculated MW of 16.31 kDa. The protein migrates as 16-19 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Galectin-10
Protein Target Info & Infographic
Gene/Protein Information For CLC (Source: Uniprot.org, NCBI)
Gene Name
CLC
Full Name
Galectin-10
Weight
16.453kDa
Alternative Names
GAL10, Gal-10, LGALS10, LGALS10A, LPPL_HUMAN CLC GAL10, Gal-10, LGALS10, LGALS10A, LPPL_HUMAN Charcot-Leyden crystal galectin galectin-10|Charcot-Leyden crystal protein|eosinophil lysophospholipase|lectin, galactoside-binding, soluble, 10|lysolecithin acylhydrolase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CLC, check out the CLC Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CLC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant Galectin-10 protein, AF (PROTQ05315-2)
Hello CJ!
No publications found for PROTQ05315-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Galectin-10 protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Galectin-10 protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
