Click image to see more details
Product Info Summary
| SKU: | PROTP48023-4 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant FasL (Fas ligand) protein, AF
View all Fas Ligand/TNFSF6 recombinant proteins
SKU/Catalog Number
PROTP48023-4
Size
5ug,20ug,100ug
Tag
His-SUMO Tag (N-term)
Description
Fas Ligand (FasL) is a 17.34 kDa tumor necrosis factor with 152 amino acid residues. FasL is expressed from lymphoid tissue and secreted to blood. Binding to its receptor, TNFRSF6/FAS, leads to induce apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant FasL (Fas ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP48023-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
31.485kDa
Molecular weight
The protein has a calculated MW of 29.51 kDa. The protein migrates as 30-35 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce apoptosis in Jurkat cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human FasL is > 1 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL with polyhistidine tag and sumo tag at the N- terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human FasL
Protein Target Info & Infographic
Gene/Protein Information For FASLG (Source: Uniprot.org, NCBI)
Gene Name
FASLG
Full Name
Tumor necrosis factor ligand superfamily member 6
Weight
31.485kDa
Superfamily
tumor necrosis factor family
Alternative Names
soluble Fas Ligand (sFasL), TNFSF6, CD95L, Apo I Ligand, APTL, APT1LG1, CD178 FASLG ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A Fas ligand tumor necrosis factor ligand superfamily member 6|CD95 ligand|Fas ligand (TNF superfamily, member 6)|apoptosis (APO-1) ligand 1|apoptosis ligand|fas ligand|mutant tumor necrosis factor family member 6|tumor necrosis factor ligand 1A
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on FASLG, check out the FASLG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FASLG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant FasL (Fas ligand) protein, AF (PROTP48023-4)
Hello CJ!
No publications found for PROTP48023-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant FasL (Fas ligand) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant FasL (Fas ligand) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
