GADD45GIP1 (NM_052850) Human Recombinant Protein

CRIF1 protein,

Product Info Summary

SKU: PROTQ8TAE8
Size: 20 µg
Source: HEK293T

Product Name

GADD45GIP1 (NM_052850) Human Recombinant Protein

View all CRIF1 recombinant proteins

SKU/Catalog Number

PROTQ8TAE8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human growth arrest and DNA-damage-inducible, gamma interacting protein 1 (GADD45GIP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GADD45GIP1 (NM_052850) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TAE8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.2 kDa

Amino Acid Sequence

MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS

Validation Images & Assay Conditions

Gene/Protein Information For GADD45GIP1 (Source: Uniprot.org, NCBI)

Gene Name

GADD45GIP1

Full Name

Growth arrest and DNA damage-inducible proteins-interacting protein 1

Weight

25.2 kDa

Superfamily

mitochondrion-specific ribosomal protein mL64 family

Alternative Names

CKBBP2; CKII beta-associating protein; CR6 interacting factor 1; CRIF1p53-responsive gene 6 protein; growth arrest and DNA damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; MGC4667; MGC4758; papillomavirus L2 interacting nuclear protein 1; Papillomavirus L2-interacting nuclear protein 1; Plinp1; PLINP-1CKII beta binding protein 2; PRG6CR6-interacting factor 1 GADD45GIP1 CKBBP2, CKbetaBP2, CRIF1, MRP-L59, PLINP, PLINP-1, PRG6, Plinp1 GADD45G interacting protein 1 growth arrest and DNA damage-inducible proteins-interacting protein 1|39S ribosomal protein L59, mitochondrial|CKII beta binding protein 2|CKII beta-associating protein|CR6 interacting factor 1|growth arrest and DNA-damage-inducible, gamma interacting protein 1|growth arrest- and DNA damage-inducible GADD45G-interacting protein|mitochondrial large ribosomal subunit protein CRIF1|mitochondrial large ribosomal subunit protein mL64|p53-responsive gene 6 protein|papillomavirus L2 interacting nuclear protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GADD45GIP1, check out the GADD45GIP1 Infographic

GADD45GIP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GADD45GIP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TAE8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GADD45GIP1 (NM_052850) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GADD45GIP1 (NM_052850) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GADD45GIP1 (NM_052850) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TAE8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product