CSDC2 (NM_014460) Human Recombinant Protein

PIPPIN protein,

Product Info Summary

SKU: PROTQ9Y534
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CSDC2 (NM_014460) Human Recombinant Protein

View all PIPPIN recombinant proteins

SKU/Catalog Number

PROTQ9Y534

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CSDC2 (NM_014460) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y534)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.6 kDa

Amino Acid Sequence

MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS

Validation Images & Assay Conditions

Gene/Protein Information For CSDC2 (Source: Uniprot.org, NCBI)

Gene Name

CSDC2

Full Name

Cold shock domain-containing protein C2

Weight

16.6 kDa

Alternative Names

cold shock domain containing C2, RNA binding; cold shock domain-containing protein C2; dJ347H13.2; PIPPIN; RNA-binding protein PIPPin CSDC2 PIPPIN, dJ347H13.2 cold shock domain containing C2 cold shock domain-containing protein C2|RNA-binding protein pippin|cold shock domain containing C2, RNA binding

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSDC2, check out the CSDC2 Infographic

CSDC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSDC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y534

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CSDC2 (NM_014460) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CSDC2 (NM_014460) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CSDC2 (NM_014460) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y534
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product