CLEC17A (NM_207390) Human Recombinant Protein

CLEC17A protein,

Recombinant protein of human C-type lectin domain family 17, member A (CLEC17A)

Product Info Summary

SKU: PROTQ6ZS10
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CLEC17A (NM_207390) Human Recombinant Protein

View all CLEC17A recombinant proteins

SKU/Catalog Number

PROTQ6ZS10

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human C-type lectin domain family 17, member A (CLEC17A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CLEC17A (NM_207390) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6ZS10)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.2 kDa

Amino Acid Sequence

MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMTGLDLAAVTCPPPQLAVNLEPSPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHLLGARGTQ

Validation Images & Assay Conditions

Gene/Protein Information For CLEC17A (Source: Uniprot.org, NCBI)

Gene Name

CLEC17A

Full Name

C-type lectin domain family 17, member A

Weight

32.2 kDa

Alternative Names

C-type lectin domain family 17, member A CLEC17A C-type lectin domain containing 17A C-type lectin domain family 17, member A|C-type lectin domain family 17 member A|prolectin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLEC17A, check out the CLEC17A Infographic

CLEC17A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLEC17A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used CLEC17A (NM_207390) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CLEC17A (NM_207390) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CLEC17A (NM_207390) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6ZS10
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.