Anti-Toll-like Receptor 4 TLR4 Antibody

Product Name

Anti-Toll-like Receptor 4 TLR4 Antibody

View all TLR4 Antibodies

SKU/Catalog Number

A00017

Size

200µg

Form

Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

Description

Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog # A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Toll-like Receptor 4 TLR4 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00017)

Host

Goat

Contents

Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

Synthetic peptide corresponding to aa 161-192 (L¹⁶¹IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC¹⁹²) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A00017 is reactive to TLR4 in Human, Mouse

Reconstitution

Calculated molecular weight

83786 MW

Background of TLR4

Anti-Glycogen Synthase 1 pS641 antibody is validated by IHC, Western Blot and ELISA. Human muscle glycogen synthase (GS) is responsible for the biosynthesis of glycogen from phosphorylated glucose units. Mammalian liver and muscle contain GS consisting of four subunits with a total molecular weight of 360,000. GS is subject to regulation through both allosteric and covalent modification and occurs in two forms: the phosphorylated inactive form, and the dephosphorylated active form. GS is inactivated by the serine/threonine kinase called glycogen synthase kinase-3 that mainly functions to phosphorylate muscle glycogen synthase. This antibody is specific for the phosphorylated form of GS at S641. Phosphorylation of GS at S641 has been associated with Antiphospholipid Antibody Syndrome.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00017 is guaranteed for IF, IHC Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunocytochemistry (acetone fixed cells, >1:400)
Immunohistochemistry (paraffin sections, >1:250)
Western Blot (>1:1,000)
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.

Validation Images & Assay Conditions

Gene/Protein Information For TLR4 (Source: Uniprot.org, NCBI)

Alternative Names

muscle glycogen synthase pS641, glycogen synthase pS641, Glycogen, Glycogen synthase 1 (muscle), Glycogen synthase 1, Glycogen synthase1, GYS 1, GYS-1, GYS1, Starch synthase muscle TLR4 ARMD10, CD284, TLR-4, TOLL toll like receptor 4 toll-like receptor 4|hToll|homolog of Drosophila toll|toll like receptor 4 protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis